TGFB2

TGFB2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

1TFG, 2TGI, 4KXZ

Ідентифікатори
Символи TGFB2, TGF-beta2, transforming growth factor beta 2, G-TSF
Зовнішні ІД OMIM: 190220 MGI: 98726 HomoloGene: 2432 GeneCards: TGFB2
Пов'язані генетичні захворювання
хронічне обструктивне захворювання легень, Loeys-Dietz syndrome[1]
Онтологія гена
Молекулярна функція

• type II transforming growth factor beta receptor binding
• signaling receptor binding
• type III transforming growth factor beta receptor binding
• cytokine activity
• transforming growth factor beta receptor binding
• growth factor activity
• protein homodimerization activity
• amyloid-beta binding
• GO:0001948, GO:0016582 protein binding
• protein heterodimerization activity

Клітинна компонента

• extracellular region
• GO:0005578 Позаклітинна матриця
• platelet alpha granule lumen
• міжклітинний простір
• аксон
• neuronal cell body
• collagen-containing extracellular matrix

Біологічний процес

• розвиток ока
• regulation of transforming growth factor beta2 production
• response to progesterone
• смерть клітини
• cardioblast differentiation
• positive regulation of integrin biosynthetic process
• protein phosphorylation
• positive regulation of heart contraction
• positive regulation of neuron apoptotic process
• Ангіогенез
• negative regulation of epithelial cell proliferation
• uterine wall breakdown
• negative regulation of alkaline phosphatase activity
• negative regulation of macrophage cytokine production
• positive regulation of cell adhesion mediated by integrin
• проліферація
• transforming growth factor beta receptor signaling pathway
• negative regulation of cell population proliferation
• positive regulation of stress-activated MAPK cascade
• cell-cell junction organization
• extrinsic apoptotic signaling pathway
• collagen fibril organization
• positive regulation of epithelial cell migration
• neutrophil chemotaxis
• positive regulation of cell growth
• response to wounding
• negative regulation of cell growth
• positive regulation of cardioblast differentiation
• glial cell migration
• Загоєння ран
• positive regulation of ossification
• cardiac muscle cell proliferation
• positive regulation of epithelial to mesenchymal transition
• odontogenesis
• positive regulation of timing of catagen
• positive regulation of immune response
• regulation of complement-dependent cytotoxicity
• positive regulation of protein secretion
• Епітеліально-мезенхімальний перехід
• embryonic digestive tract development
• response to hypoxia
• cell-cell signaling
• positive regulation of pathway-restricted SMAD protein phosphorylation
• heart morphogenesis
• platelet degranulation
• salivary gland morphogenesis
• generation of neurons
• negative regulation of immune response
• GO:0000767 cell morphogenesis
• positive regulation of cell population proliferation
• positive regulation of phosphatidylinositol 3-kinase signaling
• cell migration
• activation of protein kinase activity
• positive regulation of cell division
• cardiac epithelial to mesenchymal transition
• BMP signaling pathway
• розвиток клітин
• skeletal system development
• розвиток нирки
• neural tube closure
• hair follicle development
• outflow tract septum morphogenesis
• membranous septum morphogenesis
• heart valve morphogenesis
• atrioventricular valve morphogenesis
• pulmonary valve morphogenesis
• endocardial cushion morphogenesis
• cardiac right ventricle morphogenesis
• ventricular trabecula myocardium morphogenesis
• endocardial cushion fusion
• atrial septum primum morphogenesis
• neural retina development
• heart development
• male gonad development
• кровотворення
• embryonic limb morphogenesis
• hair follicle morphogenesis
• ascending aorta morphogenesis
• dopamine biosynthetic process
• positive regulation of cell cycle
• negative regulation of Ras protein signal transduction
• somatic stem cell division
• neuron development
• inner ear development
• uterus development
• pathway-restricted SMAD protein phosphorylation
• ventricular septum morphogenesis
• atrial septum morphogenesis
• pharyngeal arch artery morphogenesis
• regulation of apoptotic process involved in outflow tract morphogenesis
• substantia propria of cornea development
• cranial skeletal system development
• negative regulation of epithelial to mesenchymal transition involved in endocardial cushion formation
• positive regulation of epithelial to mesenchymal transition involved in endocardial cushion formation
• regulation of signaling receptor activity
• negative regulation of gene expression
• negative regulation of angiogenesis
• positive regulation of Notch signaling pathway
• SMAD protein signal transduction
• positive regulation of pri-miRNA transcription by RNA polymerase II
• embryo development ending in birth or egg hatching
• regulation of timing of catagen
• secondary palate development
• regulation of cell population proliferation
• regulation of apoptotic process
• regulation of MAPK cascade

Джерела:Amigo / QuickGO
Шаблон експресії




Більше даних
Ортологи
Види Людина Миша
Entrez
7042
21808
Ensembl
ENSG00000092969
ENSMUSG00000039239
UniProt
P61812
P27090
RefSeq (мРНК)
NM_003238
NM_001135599
NM_009367
NM_001329107
RefSeq (білок)
NP_001129071
NP_003229
NP_001316036
NP_033393
Локус (UCSC) Хр. 1: 218.35 – 218.44 Mb Хр. 1: 186.35 – 186.44 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TGFB2 (англ. Transforming growth factor beta 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 414 амінокислот, а молекулярна маса — 47 748[5].

Послідовність амінокислот
1020304050
MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKL
TSPPEDYPEPEEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYA
KEVYKIDMPPFFPSENAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFR
VFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLS
FDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARF
AGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQTNRRK
KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGAC
PYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKI
EQLSNMIVKSCKCS

Кодований геном білок за функціями належить до факторів росту, мітогенів. Секретований назовні.

Література

  • Webb N.R., Madisen L., Rose T.M., Purchio A.F. (1988). Structural and sequence analysis of TGF-beta 2 cDNA clones predicts two different precursor proteins produced by alternative mRNA splicing. DNA. 7: 493—497. PMID 2850146 DOI:10.1089/dna.1.1988.7.493
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Daopin S., Piez K.A., Ogawa Y., Davies D.R. (1992). Crystal structure of transforming growth factor-beta 2: an unusual fold for the superfamily. Science. 257: 369—373. PMID 1631557 DOI:10.1126/science.1631557
  • Schlunegger M.P., Gruetter M.G. (1992). An unusual feature revealed by the crystal structure at 2.2-A resolution of human transforming growth factor-beta 2. Nature. 358: 430—434. PMID 1641027 DOI:10.1038/358430a0
  • Marquardt H., Lioubin M.N., Ikeda T. (1987). Complete amino acid sequence of human transforming growth factor type beta 2. J. Biol. Chem. 262: 12127—12131. PMID 3476488

Примітки

  1. ↑ Захворювання, генетично пов'язані з TGFB2 переглянути/редагувати посилання на ВікіДаних.
  2. ↑ Human PubMed Reference:.
  3. ↑ Mouse PubMed Reference:.
  4. ↑ HUGO Gene Nomenclature Commitee, HGNC:11768 (англ.) . Архів оригіналу за 18 червня 2017. Процитовано 25 серпня 2017.
  5. ↑ UniProt, P61812 (англ.) . Архів оригіналу за 14 серпня 2017. Процитовано 25 серпня 2017.

Див. також

  • Хромосома 1
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»

На цю статтю не посилаються інші статті Вікіпедії.
Будь ласка розставте посилання відповідно до прийнятих рекомендацій.